HBVdb

Dataset for protein MHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***** *********.*****:************.***.*************.***:******* ** ***.* * ***:
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIaSLTSSIFSKTGDPaMNMENITSGLLGPLLVLQAVCFLLTKI
     i         k     l            v   v             v   k       r  p   g f s   v
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ***:************ ********* ********  **********.*************** ***************
LTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
x   k            e         x        qi          r               g               
r                                                                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************* ***.******** *****************:*:***:************. *.*****
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
                     x   p        i                 l n   d            ap a     
                                                                                

       250       260       270       280  
....:....|....:....|....:....|....:....|..
*** **  .:**:******* .** **************** 
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
   i  psam  m       yn  r                x
                                          
© 1998-2019