HBVdb

Dataset for protein Pol of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****  .****:********************** ******:*:********************** *************
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNhRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTiPVFNPDWLTPSFP
    cpr    v                      l      h h                      v             
      q                           r                               x             
                                                                  a             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*************** ***.** ****:********* ****************:**:****: ********* *****
DIHLHQDLIQKCEQFVGPLTtNERRRLKLIMPARFYPKvTKYFPLDKGIKPYYPENVVNHYFKTRHYLHTLWKAGILYKR
n               r   k  v    m         a                h  d    at         r     
                                      g                         k               
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************** ***********:* ** *** :******************************.****.*******
ESTHSASFCGSPYSWEQELQHGSTSLnGEKGHGTEsFCAQSSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRS
              x           h x  x   pl                              r    g       
                                   x                                            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *.*******.*.******.****:******** *:******::******** ***** ************ .**:*:*
GRLRSRVHTPTRWPSGVEPSGTGHSdNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGHAVELNTVPPSTVGSESKGsV
 s w       w a      s    n        r q      et        r     x            rp  q a 
                                                                            e   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **********:**:****************************.**************.****.****************
fSCWWLQFRNTEPCSDYCLSHIINLLEDWGPCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTtESRLVVDFSQFSRGTT
s          k  a                            k              s    k                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************** *************** *********************** *****:**:***
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSTSRIyNHQHGTLQNLHH
                           s               r                       n     s  d   
                                                                   x            
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****.*********:*************:*********:******:*********************.*:**:*******
SCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
    t         k             v         l      m                     g v  v       
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:********************** ***:****** *************:***:** ********************
QHLESLYTAVTNFLLSVGIHLNTAKTKwWGYSLHFMGYiIGSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLL
    a                      r   t      r             q   n  x                    
                           x          v                 e                       
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************* *:************* :**:.*******************************:**** 
GFAAPFTQCGYPALMPLYACITAKQAFVFSPTYKAFLCKQYmNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
                     x n             rq  lt                               l    e
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************** *******************:******************* ************* **
APLPIHTAELLAACFARSRSGADiIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLcRP
                       v                   i                   q             y  
                       x                                                        
                                                                                

       810       820       830       840   
....:....|....:....|....:....|....:....|...
****.***:************** * ******.*****:****
LLRLpFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
    s   s              f q      g     t    
                                           
                                           
© 1998-2019